Everything below concerns reconstitution. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2026-02-12. Where a claim depends on a specific study, the study is described rather than over-claimed.
Biological interest in this peptide centers on its relationship to actin dynamics. Thymosin beta-4 binds monomeric actin through an LKKTET motif, and a short sequence carrying that motif can compete with other actin-binding proteins in cell-free preparations. Investigators propose that such competition shifts the balance between filament assembly and disassembly, which in turn affects how readily a cell extends protrusions and migrates. Most of the supporting observations come from cultured cells and purified protein systems rather than from intact organisms.
Animal work has examined the peptide in models of cardiac injury, skin wounding, and corneal repair, with reported outcomes covering cell migration, inflammatory cell influx, and tissue remodeling. Several of those experiments used the full-length protein or longer fragments instead of the seven-residue sequence, which makes direct comparison between reports difficult. Results are generally described as tissue-dependent, and effect sizes vary considerably across laboratories. Independent replication is uneven, so the overall picture is incomplete rather than settled.
Peptide bonds are susceptible to hydrolysis under extreme pH and to enzymatic cleavage if proteases are present. Heat, oxidising agents, and prolonged exposure to light also contribute to loss of material. Aggregation can occur at high concentrations or in certain buffer systems, and it may not be visible to the eye. Storage at -20 C or below is typical for both powder and aliquoted solutions, and desiccation of the powder is preferred.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography together with mass spectrometry. The chromatogram provides a purity estimate as a percentage of total peak area, while the mass spectrum confirms that the observed mass matches the expected value. Amino acid analysis or tandem mass spectrometry sequencing can provide additional confirmation. Reported purity figures depend on the column, gradient, and detection wavelength, so values from different laboratories are not directly comparable without method details.
Lyophilised peptide is normally reconstituted with sterile water or a neutral buffer shortly before use. Because repeated freeze-thaw cycles can degrade the material, dividing a reconstituted solution into single-use aliquots is a common practice. Working solutions are usually kept cold and protected from light. The exact shelf life depends on concentration, buffer composition, and handling, so it is often determined empirically rather than assumed.
| Property | Value | Notes |
|---|---|---|
| Common synonyms | Thymosin beta-4 fragment; TB4 fragment | Naming is inconsistent across suppliers and publications |
| Reported sequence | Ac-LKKTETQ | Corresponds to residues 17-23 of the parent protein |
| Frequently cited registry number | 77591-33-4 | Associated with full-length thymosin beta-4 rather than the fragment |
| Common supplied form | Freeze-dried solid | Often presented as an acetate or trifluoroacetate salt |
| Regulatory treatment | Varies by country | Frequently handled as a research chemical; not broadly approved as a therapeutic |
Material is normally supplied as a lyophilised powder in a sealed vial. The powder is hygroscopic, so exposure to humid air leads to water uptake, caking and gradual loss of the fluffy texture that indicates a good freeze-dry. Vials are best kept sealed with desiccant, protected from light and stored cold. Letting a cold vial warm to room temperature before opening reduces condensation on the contents. Purity is normally reported from a chromatographic run, and that figure applies to the batch as tested rather than to the vial after repeated opening.
Once dissolved, the peptide is far less stable than the dry powder. Aqueous solutions are subject to hydrolysis, oxidation at susceptible residues and gradual loss of material through adsorption onto glass and plastic surfaces. Terminal glutamine can cyclise under some conditions, producing a related species that complicates purity assessment. Dilute solutions tend to lose a larger fraction of material to surfaces than concentrated ones. Buffers, pH and ionic strength all influence the rate of change, so stability figures are only meaningful when those parameters are stated alongside the storage interval.
Detection in biological samples relies on mass spectrometry, typically liquid chromatography coupled to tandem mass spectrometry after peptide extraction and enrichment. Intact peptides can also be confirmed by high-resolution mass measurement together with fragmentation data. Detection windows in urine are short because the peptide is degraded by proteases and cleared quickly, and concentrations are low. Many jurisdictions treat the compound as a prohibited substance in sport, grouped with peptide hormones and related factors, while it is not an approved therapeutic product. Identity and purity statements therefore rest on certificates of analysis, ideally issued by an independent laboratory.
Dry peptide powder is commonly kept at −20 °C in a desiccated container away from light, a practice that limits moisture uptake and oxidation. Once dissolved, solutions are generally held at 2–8 °C for short periods or frozen at −20 °C or lower for longer storage, with repeated freeze-thaw cycles avoided. Hydrolysis and oxidation are the main degradation routes for peptides in solution, and both accelerate at higher temperature or extreme pH. Published stability data specific to TB-500 are limited, so shelf life should be treated as uncertain.
Identity and purity checks for peptide material typically combine reversed-phase high-performance liquid chromatography with mass measurement, since retention time alone cannot confirm a sequence. Mass measurement verifies the expected molecular mass within instrument tolerance, while chromatographic peak area provides a purity estimate. Anti-doping analysis of urine uses related but more sensitive workflows, sometimes after solid-phase extraction. For research material, batch documentation, certificate content, and independent testing are common points of scrutiny, because supply chains outside pharmaceutical regulation vary widely in the paperwork they provide.
Reconstitution of a lyophilized peptide is normally done with sterile water or a suitable buffer under aseptic conditions. Adding solvent down the vial wall and allowing gentle dissolution instead of vigorous vortexing reduces the chance of aggregation, which can lower the effective concentration of the resulting solution. Concentrated stocks are usually diluted into working buffer shortly before use. Because no standard preparation protocol exists for TB-500 specifically, laboratories adapt general peptide handling practice, and reported results may reflect differing preparation choices.
TB-500 is a research peptide whose sequence matches residues 17 to 23 of thymosin beta-4, a 43-residue protein present in most mammalian cells. The chain is seven amino acids long, written as LKKTETQ, and is normally supplied with an acetyl group on the N-terminus. Suppliers list it as a lyophilised powder under the code name TB-500, and the same sequence appears elsewhere in catalogues as the thymosin beta-4 actin-binding fragment. The label is commercial rather than systematic, so no single authority fixes exactly what TB-500 denotes.
Thymosin beta-4 was isolated from calf thymus in the early 1980s and later characterised as an abundant intracellular actin-sequestering protein. Interest in short synthetic fragments grew once the actin-binding motif had been mapped to the middle of the sequence. TB-500 came out of that line of work as a truncated analogue rather than a natural isolate, and it is now sold mainly to laboratories. Published studies on the fragment have been largely in vitro or in animal models, and controlled human trials remain sparse, so claims about effects in people rest on extrapolation.
Literature and online discussion often conflate TB-500 with full-length thymosin beta-4, even though the two differ in size and are not interchangeable in analytical terms. The fragment is produced by solid-phase peptide synthesis, and the product is a defined seven-residue chain rather than a biological extract. Because the term is a trade-style label, two vendors may supply materials of the same nominal sequence but different counter-ion content, purity, or water content. Comparisons across studies are therefore difficult unless the exact sequence and purity are reported.
Thymosin beta-4 contains 43 amino acids and has a reported molecular mass near 4963 Da. The short fragment most often associated with the TB-500 label, an acetylated chain beginning LKKTETQ, has a reported mass near 889 Da, so the two are easily separated in analytical work. Mass spectrometry and amino acid analysis can confirm which material is present in a given sample. Statements treating TB-500 and thymosin beta-4 as interchangeable are therefore imprecise, even though the two appear together in much of the same literature.
Interest in the compound comes largely from studies of the parent protein, which participates in actin sequestration, cell migration and tissue repair processes. Whether a short fragment reproduces those activities is a separate question that remains open in the published record. Many summaries describe mechanisms by analogy to thymosin beta-4 rather than from direct measurements on the fragment. Claims about activity should be treated as provisional unless a cited study specifies the exact peptide, its purity and the assay used.
TB-500 is a laboratory label applied to a short synthetic peptide that is widely described as a fragment of thymosin beta-4, an actin-binding protein present in most mammalian cells. Suppliers and review articles usually present TB-500 as the N-terminal region of that protein, but the exact sequence attached to the name is not consistent across sources. Some product descriptions list a seven-residue chain; others use the label loosely for the parent protein itself. Because of that variation, any technical discussion of TB-500 needs to state which sequence is meant.
Cocaine is a powerful psychostimulant and known to be one of the most widely used substances recreationally. Cocaine is a nonselective, reuptake inhibitor of the norepinephrine, serotonin, and dopamine transporters. This thwarts the absorption of these chemicals into the presynaptic terminal and allows a large concentration of dopamine, serotonin and norepinephrine to build up in the synaptic cleft. The potential for cocaine addiction is thought to be a result of its effects on dopamine transporters in the CNS, while it has been suggested that the life-threatening cardiovascular effects of cocaine may involve the inhibition of NETs at sympathetic and CNS autonomic synapses.
Claire Darke, former mayor of Wolverhampton and a longtime Labour councillor, resigns from the Labour Party, citing disillusionment with its direction under Keir Starmer. She specifically criticizes the party's stance on austerity and its "morally wrong" position on Gaza, which she sees as neglecting the suffering of the Palestinian people. 25 June – Emperor Naruhito and Empress Masako of Japan begin their state visit to the United Kingdom. 2024 United Kingdom general election date betting controversy: The Conservative Party withdraws its support for Craig Williams and Laura Saunders as election candidates. Cabinet minister Alister Jack, who previously said he had won £2,100 by betting on the date of the election, then said he was joking, issues a statement in which he says he did not place a bet on the election. Russell George, the Senedd member for Montgomeryshire, becomes the fifth Conservative politician to be investigated by the Gambling Commission for election betting. The Metropolitan Police confirms that the Gambling Commission are investigating a further five police officers for placing bets on the date of the election. Labour suspends Kevin Craig, their candidate for Central Suffolk and North Ipswich, after the Gambling Commission launches an unrelated investigation into him for placing a bet against himself losing in his constituency. LBC's Nick Ferrari moderates an immigration policy debate between Home Secretary James Cleverly and Shadow Home Secretary Yvette Cooper.
Plutonium (specifically, plutonium-238) was first produced, isolated, and then chemically identified between December 1940 and February 1941 by Glenn T. Seaborg, Edwin McMillan, Emilio Segrè, Joseph W. Kennedy, and Arthur Wahl by deuteron bombardment of uranium in the 60-inch (150 cm) cyclotron at the Berkeley Radiation Laboratory at the University of California, Berkeley. Neptunium-238 was created directly by the bombardment but decayed by beta emission with a half-life of a little over two days, which indicated the formation of element 94. The first bombardment took place on December 14, 1940, and the new element was first identified through oxidation on the night of February 23–24, 1941. A paper documenting the discovery was prepared by the team and sent to the journal Physical Review in March 1941, but publication was delayed until a year after the end of World War II due to security concerns. At the Cavendish Laboratory in Cambridge, Egon Bretscher and Norman Feather realized that a slow neutron reactor fuelled with uranium would theoretically produce substantial amounts of plutonium-239 as a by-product. They calculated that element 94 would be fissile, and had the added advantage of being chemically different from uranium, and could easily be separated from it. McMillan had recently named the first transuranic element neptunium after the planet Neptune, and suggested that element 94, being the next element in the series, be named for what was then considered the next planet, Pluto.
The decline of the Roman Empire led to the disappearance or destruction of much knowledge, though physicians still incorporated many aspects of the Greek tradition into training and practice. In Byzantium and the Islamic world, many of the Greek works were translated into Arabic and many of the works of Aristotle were preserved.
Sources: en.wikipedia.org
=== Bleeding time === Bleeding time was developed as a test of platelet function by Duke in 1910. Duke's test measured the time taken for bleeding to stop from a standardized wound in the ear lobe that was blotted every 30 seconds, considering less than 3 minutes as normal. Bleeding time has low sensitivity and specificity for mild to moderate platelet disorders and is no longer recommended for screening.
=== More examples === acetaldehyde dehydrogenase alcohol dehydrogenase Delta12-fatty acid dehydrogenase glutamate dehydrogenase (an enzyme that can convert glutamate to α-Ketoglutarate and vice versa). lactate dehydrogenase (used to convert NADH back to NAD+ in anaerobic glycolysis, and in the back reaction to produce NADH) pyruvate dehydrogenase (A common enzyme that feeds the TCA Cycle by converting pyruvate to acetyl CoA, using NAD+. In this reaction, the substrate not only is oxidized but also loses a carbon dioxide molecule, and is attached to the CoA coenzyme.) glucose-6-phosphate dehydrogenase (involved in the pentose phosphate pathway, producing NADPH) glyceraldehyde-3-phosphate dehydrogenase (involved in glycolysis, uses NAD+) sorbitol dehydrogenase TCA cycle examples:
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
Sources: en.wikipedia.org
=== DDM === Direct Drive Monitor (DDM) 1.0 standard was approved in December 2008. It allows for controller-less monitors where the display panel is directly driven by the DisplayPort signal, although the available resolutions and color depth are limited to two-lane operation.
== Terminology == A number of terms are used to describe critical illness polyneuropathy, partially because there is often neuropathy and myopathy in the same person, and nerve and muscle degeneration are difficult to distinguish from each other in this condition. Terms used for the condition include: critical illness polyneuromyopathy, critical illness neuromyopathy, and critical illness myopathy and neuropathy (CRIMYNE). Bolton's neuropathy is an older term, which is no longer used.
==== Triglyceride ==== In this process, green coffee beans are soaked in a hot water and coffee solution to draw the caffeine to the surface of the beans. Next, the beans are transferred to another container and immersed in coffee oils that were obtained from spent coffee grounds and left to soak. After several hours of high temperatures, the triglycerides in the oils remove the caffeine, but not the flavor elements, from the beans. The beans are separated from the oils and dried. The caffeine is removed from the oils, which are reused to decaffeinate another batch of beans. This is a direct-contact method of decaffeination.
=== Future developments === Several medications designed to address the root cause are under development, including gene therapy and antisense drugs. Other medications used include corticosteroids to slow muscle degeneration. Physical therapy, orthopedic braces, and corrective surgery may help with some symptoms while assisted ventilation may be required in those with weakness of breathing muscles. Outcomes depend on the specific type of disorder. In February 2024, the results of a 48-week trial with Vamorolone in patients with Duchenne muscular dystrophy (The VISION-DMD study) were published. Patients showed improvements in motor outcomes seen with 6 mg/kg/d of Vamorolone at 24 weeks of treatment and were maintained for 48 weeks of treatment. As well, bone morbidities of prednisone (stunting of growth and declines in serum bone biomarkers) were reversed when treatment transitioned to Vamorolone.
Sources: en.wikipedia.org
The leading proposal involves sequestration of monomeric actin, which would alter cytoskeletal turnover and cell movement. The actin-binding motif shared with the parent protein is central to that idea. Direct confirmation in whole organisms remains limited.
Very few controlled human studies focus on the seven-residue sequence itself. Most clinical data concern the full-length protein in cardiac or ophthalmic settings. Conclusions drawn for one form should not be assumed to transfer to the other.
Detection normally relies on reversed-phase liquid chromatography paired with mass spectrometry. Chromatographic retention time establishes the expected elution window, and the mass spectrum confirms the molecular ion. Immunoassays exist but can cross-react with related peptides.
The lyophilised powder is typically held at -20 C or lower in a dry, dark place. Reconstituted solutions are aliquoted and frozen to avoid repeated freeze-thaw cycles.