reverse-phase HPLC raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2026-03-31. Anything still debated is marked as such rather than presented as settled.
Controlled human trials of the short fragment are scarce. Much of what appears in review articles is extrapolated from animal models or from studies of the parent protein, and literature searches return a larger body of cardiac and ophthalmic work on thymosin beta-4 than on the abbreviated peptide. Regulatory treatment differs by jurisdiction, and in several countries the material is handled as a research chemical rather than an approved therapeutic. Statements about human benefit should be read as provisional.
Biological interest in this peptide centers on its relationship to actin dynamics. Thymosin beta-4 binds monomeric actin through an LKKTET motif, and a short sequence carrying that motif can compete with other actin-binding proteins in cell-free preparations. Investigators propose that such competition shifts the balance between filament assembly and disassembly, which in turn affects how readily a cell extends protrusions and migrates. Most of the supporting observations come from cultured cells and purified protein systems rather than from intact organisms.
Thymosin beta-4 itself is a small, widely expressed protein that sequesters monomeric actin and participates in cell migration, angiogenesis, and tissue repair. Researchers have examined the shortened fragment as a possible mimic of some of these activities, reasoning that the actin-binding motif lies within the first few residues. Binding to monomeric actin has been observed in cell-free systems. Whether the fragment reproduces the broader effects of the full protein in living tissue remains an open question, and findings from animal models are frequently cited without a clear bridge to human physiology.
Discussion of TB-500 appears in several distinct literatures that rarely cite one another. Peer-reviewed studies usually describe in vitro assays or small animal experiments and are cautious about extrapolation. Veterinary and sports communities circulate anecdotal reports with limited methodological detail. Commercial listings add a third layer, often using the name interchangeably with thymosin beta-4 even though the two molecules differ in size and sequence. Regulatory status varies by country, and the compound is not a licensed medicine in most jurisdictions, so readers comparing sources should check which molecule and which purity each source actually describes.
| Property | Value | Notes |
|---|---|---|
| Common synonyms | Thymosin beta-4 fragment; TB4 fragment | Naming is inconsistent across suppliers and publications |
| Reported sequence | Ac-LKKTETQ | Corresponds to residues 17-23 of the parent protein |
| Frequently cited registry number | 77591-33-4 | Associated with full-length thymosin beta-4 rather than the fragment |
| Common supplied form | Freeze-dried solid | Often presented as an acetate or trifluoroacetate salt |
| Regulatory treatment | Varies by country | Frequently handled as a research chemical; not broadly approved as a therapeutic |
The compound is most often distributed as a lyophilized powder, appearing white to off-white and forming a loose cake or fluffy solid. It is hygroscopic to some degree, so brief exposure to humid air can add water weight and complicate weighing. The peptide dissolves readily in water and in neutral aqueous buffers, and aqueous solubility is generally described as high, well above the concentrations used in typical assays. Some polar organic solvents are also usable, which matters when a concentrated stock is prepared before dilution into buffer.
Storage recommendations center on keeping the dry powder cold, dry, and dark. A freezer at -20 degrees Celsius or below is conventional, and desiccant is often included to limit moisture uptake. Once dissolved, the peptide is less stable, and solutions are typically kept frozen and thawed only once. Repeated freeze-thaw cycles are a common source of losses because they promote aggregation and adsorption to container surfaces. Working aliquots are therefore prepared in advance, and glass or low-binding plastic is usually preferred over ordinary laboratory plastic.
TB-500 is a laboratory label applied to a short synthetic peptide that is widely described as a fragment of thymosin beta-4, an actin-binding protein present in most mammalian cells. Suppliers and review articles usually present TB-500 as the N-terminal region of that protein, but the exact sequence attached to the name is not consistent across sources. Some product descriptions list a seven-residue chain; others use the label loosely for the parent protein itself. Because of that variation, any technical discussion of TB-500 needs to state which sequence is meant.
Thymosin beta-4 contains 43 amino acids and has a reported molecular mass near 4963 Da. The short fragment most often associated with the TB-500 label, an acetylated chain beginning LKKTETQ, has a reported mass near 889 Da, so the two are easily separated in analytical work. Mass spectrometry and amino acid analysis can confirm which material is present in a given sample. Statements treating TB-500 and thymosin beta-4 as interchangeable are therefore imprecise, even though the two appear together in much of the same literature.
Interest in the compound comes largely from studies of the parent protein, which participates in actin sequestration, cell migration and tissue repair processes. Whether a short fragment reproduces those activities is a separate question that remains open in the published record. Many summaries describe mechanisms by analogy to thymosin beta-4 rather than from direct measurements on the fragment. Claims about activity should be treated as provisional unless a cited study specifies the exact peptide, its purity and the assay used.
Once in solution, short peptides are generally less stable than the dry powder, and repeated freeze-thaw cycles are a common cause of loss. Laboratory guidance usually calls for aliquoting on first dissolution and storing aliquots at -20 °C or below, away from light. Adsorption to plastic and glass surfaces can lower measured concentration, particularly at low concentrations, so container material and buffer choice can affect results. Visible cloudiness, colour change or unexpected precipitate is a signal to re-check the material.
Purity is normally assessed by reversed-phase HPLC, with the main peak reported as a percentage of total peak area, while identity is confirmed by mass spectrometry. Electrospray and MALDI-TOF instruments are both used, and the observed mass is compared with the value calculated from the stated sequence. Ion-exchange or size-exclusion methods appear where aggregation or charge variants are of interest. Water content, counter-ion content and residual trifluoroacetate from purification are separate variables that can shift the measured mass and should be weighed when reading a certificate of analysis.
Interest in the peptide grew during the 2000s and 2010s, when studies of tendon and ligament injuries in horses reported changes in lesion size after treatment. Those reports circulated widely outside the scientific literature and shaped much of the current online discussion. Subsequent reviews noted inconsistent study design, small groups, and a shortage of independent replication. Popular descriptions often blur the line between the fragment, the complete protein, and unrelated growth factors, which complicates comparisons across sources.
TB-500 is a synthetic peptide whose sequence corresponds to a short fragment near the N-terminus of thymosin beta-4, a small protein present in most mammalian cells. The fragment is commonly cited as containing the actin-binding region of the parent molecule, which is why it appears in laboratory work on cell migration and tissue repair. Suppliers distribute it as a lyophilised powder intended for research use. Its identity is defined by amino acid sequence and by the presence of an acetyl group on the N-terminal residue.
Full-length thymosin beta-4 consists of roughly forty-three amino acids and ranks among the more abundant small proteins in the cytoplasm. The fragment is much shorter, so it cannot reproduce every function attributed to the intact molecule. In cell culture, short actin-binding motifs can interfere with filament dynamics and cell movement, but such observations come from controlled experiments rather than from whole-animal work. Whether a truncated fragment produces the same effects as the parent protein remains an open question.
Hyperuricemia associated with classic primary gout, which is caused by low uric acid renal clearance rather than uric acid overproduction, is not associated with neuropathology. Hypouricemia occurs in a number of purine disorders, in particular xanthinuria. Despite having complete absence of blood uric acid, xanthinuria patients do not have any neuropathology, nor any other disease states – other than the kidney stones caused by accumulation of insoluble xanthine in lieu of uric acid. Similarly, uric acid does not penetrate the blood–brain barrier well. However, oxidative stress due to uric acid is now thought to figure in metabolic syndrome, atherosclerosis, and stroke, all syndromes associated with high uric acid levels. Similarly, Superoxide dismutase ( "SOD" ) and SOD-mimetics such as TEMPOL ameliorate the effects of hyperuricemia. Likewise, 6-hydroxydopamine (the putative animal model for Lesch–Nyhan's neuropathy) apparently acts as a neurotoxin by generation of reactive oxygen species. It may be that oxidative stress induced by some other oxypurine such as xanthine causes the disease.
Taliban deputy spokesman Hamdullah Fitrat stated that Afghanistan regarded the strikes as "grave and inexcusable war crimes, a blatant act of brutality, and a provocative action." Afghanistan's higher education ministry claimed that about 30 students and professors were injured. Pakistan denied any responsibility in the attacks. Three children were injured in a quadcopter strike targeting the house of a PMLN leader in North Waziristan. On 28 April, Pakistan claimed to have destroyed multiple Afghan Taliban posts and vehicles in Chaman sector. On 28-29 April, Pakistani forces claimed to have killed eight militants attempting to infiltrate the border in Mohmand District and five more in North Waziristan. On 29 April, five civilians were wounded in Taliban shelling on Angoor Adda. Police foiled an attack on a post in Bannu District killing six militants. On 30 April, two security personnel were killed in a militant attack on a police post in Lakki Marwat District. Pakistani military claimed to have foiled two cross-border militant infiltrations from Afghanistan killing eight militants in Mohmand District and five in North Waziristan. On 1 May, two soldiers were wounded in a quadcopter strike from Afghanistan on their position in Mohmand District. In Bannu, a constable was killed and a civilian was wounded in a rocket attack on an armored vehicle. Militants killed Malik Saifullah, a tribal leader in North Waziristan leading to heavy skirmishes between the militants and the tribesmen, in which at least two militants were also killed.
== Function == This gene encodes a transmembrane transporter that likely plays a role in monocarboxylic acid transport. A mutation in this gene has been associated with juvenile cataracts with microcornea and renal glucosuria. [provided by RefSeq, Mar 2010].
Cecropin A Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. Cecropin B Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary structure includes two α helices. CECD from Aedes aegypti (Yellowfever mosquito). Papiliocin from Papilio xuthus (a butterfly) Cecropin P1 Peptide Sequence (SWLSKTAKKLENSAKKRISEGIAIAIQGGPR). An antibacterial peptide from Ascaris suum, a parasitic nematode that resides in the pig intestine, also belongs to this family.
Sources: en.wikipedia.org
March 19: Law facilitating donations to public or private charitable organizations, particularly those focused on increasing birth rates and protecting children and war orphans. April 23: Decree implementing the law of April 23, 1919, establishing an eight-hour workday in hotels, restaurants, cafés, and other food service establishments in the Paris region. May 9: Decree modifying the statutes of the Comédie-Française: both principal and substitute members must include at least one woman in each group. June 1: Circular regulating prostitution among women. July 25: Decree on the regulation of films; women may sit on the commission that grants film distribution visas. August 9: Competitive exams for editorial and translator-editor positions in the central administration of commerce and industry are opened to women for a provisional period of three years. August 27: Competitive exams for editorial and calculation clerk positions in the central administration of the Ministry of Labor and Social Welfare are opened to female candidates. October 24: Law protecting breastfeeding women: needy mothers breastfeeding their infants receive special allowances during the first year. October 25: Law creating and organizing chambers of agriculture in each French department; women with agricultural professions (or who had such work during the war) may vote and be elected. 1920
On 21 March, Japanese ambassador to Brazil Teiji Hayashi confirmed that prime minister Fumio Kishida would invite president Lula to the 49th G7 summit to be held from 19 to 21 May 2023 in Hiroshima, which formally took place on 6 April. In May 2023, Kishida met with Lula and announced that Japan was starting procedures to grant Brazilians travel visa exemptions and was opening a ¥30 billion line of credit to support health companies and other businesses in Brazil through Japan International Cooperation Agency (JICA). Lula said Brazil and Japan need to further develop their commercial, cultural, political and scientific relationship adding that "we have cultural bonds with Japan and a great Japanese-Brazilian community". Both leaders also discussed education, climate change, development and peace.
Following oral intake, bempedoic acid reaches highest blood plasma concentrations after 3.5 hours. Food does not affect its absorption. When in the bloodstream, 99.3% of the substance are bound to plasma proteins. About a fifth of the substance is reversibly converted by an aldo-keto reductase enzyme to a metabolite (called ESP15228) that is also pharmacologically active in form of its coenzyme A–thioester. Of ESP15228, 99.2% are bound to plasma proteins. Both bempedoic acid and the metabolite are inactivated by glucuronidation of their carboxylic acid groups. Bempedoic acid has a biological half-life of 21±11 hours. Over 95% of the substance are excreted in form of metabolites; about 70% with the urine and 30% with the feces.
Sources: en.wikipedia.org
Motilin has 22 amino acids and molecular weight of 2698 daltons. In extract from human gut and plasma, there are two basic forms of motilin. The first molecular form is the polypeptide of 22 amino acids. The second form, on the other hand, is larger and contains the same 22 amino acids as the first form but includes an additional carboxyl-terminus end. The sequences of amino acids of motilin is: Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg-Met-Gln-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln. The structure and dynamics of the gastrointestinal peptide hormone motilin have been studied in the presence of isotropic q = 0.5 phospholipid bicelles. The NMR solution structure of the peptide in acidic bicelle solution was determined from 203 NOE-derived distance constraints and six backbone torsion angle constraints. Dynamic properties for the 13Cα→1H vector in Leu-10 were determined for motilin specifically labeled with 13C at this position by analysis of multiple-field relaxation data. The structure reveals an ordered alpha-helical conformation between Glu-9 and Lys-20. The N-terminus is also well structured with a turn resembling that of a classical beta-turn. The 13C dynamics clearly show that motilin tumbles slowly in solution, with a correlation time characteristic of a large object.
Seizures are characterized by high levels of synchronized neuronal activity. One important regulator of neuronal activity is the hyperpolarizing A-type current mediated by potassium channel KV4.2. miR-324-5p downregulates KV4.2, exacerbating conditions that lead to seizure onset, and downregulation of miR-324-5p in mouse models of epilepsy is seizure-suppressive. Changes in miRNA expression are seen in epileptogenesis and in other disease pathologies. In epilepsy, miR-324-5p expression has been shown to increase and decrease at different timepoints and loci. Importantly, miR-324-5p has increased association with the RISC complex following seizure in mice, indicating more suppressive activity. Overall, this suggests that miR-324-5p plays a role in epileptogenesis via targeting of potassium channel KV4.2. miR-324-5p contributes to cardiac disease pathophysiology and cardiomyocite death through translational inhibition of Mtfr1, leading to reduced mitochondrial fission, apoptosis, and myocardial infarction.
46. Sheng Li Xue Bao. 2024 Dec 25;76(6):1032-1042. [Research progress on anti-aging effects of β-nicotinamide mononucleotide (NMN)]. [Article in Chinese] Han M(1), Hua JL(1). Author information: (1)College of Veterinary Medicine, Shaanxi Centre of Stem Cells Engineering & Technology, Northwest A&F University, Yangling 712100, China. β-Nicotinamide mononucleotide (NMN), as the precursor of nicotinamide adenine dinucleotide (NAD), plays an important role in enhancing NAD levels. Intake of NMN can alter the composition and vitality of gut microbiota, restore mitochondrial function, inhibit inflammatory pathways, improve metabolism, counteract oxidative stress, and alleviate inflammation. NMN significantly improves recovery from aging-related diseases, such as diminished heart function, reduced fertility, memory decline, and diabetes. NMN demonstrates both efficacy and safety in anti-aging. The use of NMN in China has gradually gained acceptance, highlighting the importance of exploring the mechanism of NMN in anti-aging effects and improving the biosynthesis of NMN. In addition, NMN in combination with stem cells hold promise in the treatment of aging-related degenerative diseases and promote overall human and animal health.
Sources: en.wikipedia.org
The leading proposal involves sequestration of monomeric actin, which would alter cytoskeletal turnover and cell movement. The actin-binding motif shared with the parent protein is central to that idea. Direct confirmation in whole organisms remains limited.
Very few controlled human studies focus on the seven-residue sequence itself. Most clinical data concern the full-length protein in cardiac or ophthalmic settings. Conclusions drawn for one form should not be assumed to transfer to the other.
Detection normally relies on reversed-phase liquid chromatography paired with mass spectrometry. Chromatographic retention time establishes the expected elution window, and the mass spectrum confirms the molecular ion. Immunoassays exist but can cross-react with related peptides.
No. Thymosin beta-4 is a 43-residue protein, while TB-500 refers to a seven-residue fragment corresponding to its N-terminal region. The two names are often used loosely in commercial and community writing, which obscures the difference in size, sequence, and likely behavior.